PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626206.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 512aa    MW: 56129.5 Da    PI: 7.2322
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626206.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.42.3e-31169226260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  +++++ei+Y+g+H+h+k
  XP_009626206.1 169 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-EGQITEIVYKGSHDHPK 226
                     8****************************************.***************85 PP

2WRKY106.51.4e-33333391159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_009626206.1 333 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 391
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-26159227IPR003657WRKY domain
PROSITE profilePS5081122.435163227IPR003657WRKY domain
SuperFamilySSF1182901.96E-24165227IPR003657WRKY domain
SMARTSM007743.4E-33168226IPR003657WRKY domain
PfamPF031067.5E-24169225IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-37318393IPR003657WRKY domain
SuperFamilySSF1182901.7E-29325393IPR003657WRKY domain
PROSITE profilePS5081138.825328393IPR003657WRKY domain
SMARTSM007743.1E-39333392IPR003657WRKY domain
PfamPF031062.9E-26334391IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MNLPFCKAEP SPTTGSFSKL QAVQGSGGNA AFLLTRGYSS GNTYSERKSS CFEFKFAGGS  60
SSTSGSLAAE HVISTGLNQQ PDEPLKEVQD QSHPQLVATS SLAKHEMASS KELSLSAPIN  120
VDDSSKEESL SAPMNVDAMN MRSQSNTSMQ VSLVDHKDVS SVTAERSSDD GYNWRKYGQK  180
LVKGSEFPRS YYKCTYPNCE VKKIFERSPE GQITEIVYKG SHDHPKPQLS RRFTPGALMS  240
IQEDKFFVED KFNTNAQTSK IEPISTPVSP QQVDADGPEG AVSQMQGTND DMDEDDPFVK  300
RRKMDGAVDI TPVIKPIREP RVVVQTVSEV DILDDGYRWR KYGQKVVRGN PNPRSYYKCT  360
NAGCPVRKHV ERASHDPKAV ITTYEGKHNH DVPAARSNNH EMAGSTPVTG GSRIRAEETY  420
SINLDLGVGF GYGVENGNNR QLHTVHNQVQ VSRSGMMVVQ PAAIAARYGI VNGGMSRFGP  480
IDNHVQGHGF ETLPLQPSTQ FPQNYGKILL GP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-38169394878Probable WRKY transcription factor 4
2lex_A5e-38169394878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111290.0AB711129.1 Solanum tuberosum StWRKY17 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626206.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
TrEMBLK4CHK50.0K4CHK5_SOLLC; Uncharacterized protein
STRINGSolyc07g065260.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-127WRKY family protein